Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0191200_circ_g.7 |
| ID in PlantcircBase | osa_circ_033095 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 4920014-4920195 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0191250 |
| Parent gene annotation |
Hypothetical protein. (Os07t0191250-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0191200-01:1 Os07t0191200-02:1 Os07t0191250-00:1 Os07t0191200-01:1 Os07t0191200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.196282051 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4920132-4920131(+) 4920093-4920141(-) |
| Potential amino acid sequence |
MTSYNDLNQLAEEARRRAEIARLLSQGRRISAHKKTSSSGRLLRGPSMGSSQPPPRLSSAT*(+ ) MDGPLSSRPLELVFLCAEILLPCESNLAISALLRASSASWLRSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |