Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G17930_circ_g.6 |
| ID in PlantcircBase | ath_circ_013659 |
| Alias | Ath_circ_FC1230 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 7798571-7799391 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | AT2G17930 |
| Parent gene annotation |
Phosphatidylinositol 3-and 4-kinase family protein with FAT doma in-containing protein |
| Parent gene strand | - |
| Alternative splicing | AT2G17930_circ_g.7 AT2G17930_circ_g.8 |
| Support reads | 1 |
| Tissues | inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G17930.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.166139667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7798876-7798573(-) |
| Potential amino acid sequence |
MGMKTIIWSITHAHLPRPQGMNPQALVSQSSAPQGFKGMREDELLEEGEVGKDRVTLRSKLELP VQAVLNLQVPVEHSKEVNDCKNLIKTLVMGMKTIIWSITHAHLPRPQGMNPQALVSQSSAPQGF KGMREDELLEEGEVGKDRVTLRSKLELPVQAVLNLQVPVEHSKEVNDCKNLIKTLVMGMKTIIW SITHAHLPRPQGMNPQALVSQSSAPQGFKGMREDELLEEGEVGKDRVTLRSKLELPVQAVLNLQ VPVEHSKEVNDCKNLIKTLVMGMKTIIWSITHAHLPRPQGMNPQALVSQSSAPQGFKGMREDE( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |