Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0278000_circ_g.2 |
| ID in PlantcircBase | osa_circ_019154 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 9438124-9439202 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0278000 |
| Parent gene annotation |
UDP-glucuronic acid decarboxylase. (Os03t0278000-01);UDP-glucuro nic acid decarboxylase. (Os03t0278000-02);Similar to D-TDP-gluco se dehydratase. (Os03t0278000-03) |
| Parent gene strand | + |
| Alternative splicing | Os03g0278000_circ_g.1 Os03g0278000_circ_g.3 Os03g0278000_circ_g.4 Os03g0278000_circ_g.5 Os03g0278000_circ_g.6 Os03g0278000_circ_g.7 Os03g0278000_circ_g.8 Os03g0278000_circ_g.9 |
| Support reads | 45 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0278000-01:4 Os03t0278000-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152495096 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9438996-9438194(+) 9439189-9438194(+) 9438130-9438826(-) |
| Potential amino acid sequence |
MLGLAKRVGARILLTSTSEVYGDPLEHPQTEAYWGNVNPIGHCRRQLFHWFKRQPEEVDRTPKI *(+) MLTQLVIVADNFFTGSKDNLKKWIGHPRFELIRHDVTQPLLVEVDQIYHLACPASPIFYKHNPV KTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLEHPQTEAYWGNVNPIGHCRRQLFHWFK RQPEEVDRTPKI*(+) MTNWVNISPVGLCLRVLKRITVNFRGRSQQNPSSNSLGKSKHVQGSDNVCLDGLDRVVLVEDW* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |