Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G36720_circ_g.1 |
ID in PlantcircBase | ath_circ_016884 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 15395175-15395249 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, CIRI-full |
Parent gene | AT2G36720 |
Parent gene annotation |
Acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger d omain-containing protein |
Parent gene strand | + |
Alternative splicing | AT2G36720_circ_g.2 AT2G36720_circ_g.3 AT2G36720_circ_g.4 AT2G36720_circ_g.5 AT2G36720_circ_g.6 AT2G36720_circ_g.7 AT2G36720_circ_g.8 AT2G36720_circ_g.9 AT2G36720_circ_g.10 AT2G36720_circ_g.11 AT2G36720_circ_g.12 AT2G36720_circ_g.13 |
Support reads | 4 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G36720.2:1 AT2G36720.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.145061728 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15395209-15395246(+) |
Potential amino acid sequence |
MSSLGNSTRKITRKPSESTSISPVFMSSLGNSTRKITRKPSESTSISPVFMSSLGNSTRKITRK PSESTSISPVFMSSLGNSTRKITR(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |