Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0628800_circ_g.1 |
ID in PlantcircBase | osa_circ_020715 |
Alias | Os03circ20675/Os_ciR1433 |
Organism | Oryza sativa |
Position | chr3: 23990498-23991657 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os03g0628800 |
Parent gene annotation |
Similar to H1flk (Fragment). (Os03t0628800-01) |
Parent gene strand | + |
Alternative splicing | Os03g0628800_circ_g.2 Os03g0628800_circ_g.3 Os03g0628800_circ_g.4 |
Support reads | 2/13/3 |
Tissues | leaf/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0628800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013340 |
PMCS | 0.308752795 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23990665-23990521(+) 23990507-23990498(+) |
Potential amino acid sequence |
MHSWIFCVPLGPCYRSYQPGLDRRLWHRQQEEAKEPRVGSYKLGRWGFRT*(+) MGFQDINECPQLCKLANNYLKRTKNCMDDIDDFFANILDSESLYVKFIEELDKCILGYFAFHWD HATALISQALTVDCGTASKKKLRNLVLEATS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |