Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0628800_circ_g.1 |
| ID in PlantcircBase | osa_circ_020715 |
| Alias | Os03circ20675/Os_ciR1433 |
| Organism | Oryza sativa |
| Position | chr3: 23990498-23991657 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os03g0628800 |
| Parent gene annotation |
Similar to H1flk (Fragment). (Os03t0628800-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0628800_circ_g.2 Os03g0628800_circ_g.3 Os03g0628800_circ_g.4 |
| Support reads | 2/13/3 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0628800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013340 |
| PMCS | 0.308752795 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23990665-23990521(+) 23990507-23990498(+) |
| Potential amino acid sequence |
MHSWIFCVPLGPCYRSYQPGLDRRLWHRQQEEAKEPRVGSYKLGRWGFRT*(+) MGFQDINECPQLCKLANNYLKRTKNCMDDIDDFFANILDSESLYVKFIEELDKCILGYFAFHWD HATALISQALTVDCGTASKKKLRNLVLEATS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |