Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0948400_circ_g.2 |
ID in PlantcircBase | osa_circ_005816 |
Alias | Os01circ33509/Os_ciR1723 |
Organism | Oryza sativa |
Position | chr1: 41720830-41721140 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
Parent gene | Os01g0948400 |
Parent gene annotation |
Similar to Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C reductase). (Os01t0948400-01);Similar to pyrroline 5-carbo xylate reductase. (Os01t0948400-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 5/10/32/27 |
Tissues | panicle/root/root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0948400-02:1 Os01t0948400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002685* osi_circ_011199 |
PMCS | 0.484800589 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
41721056-41720974(-) |
Potential amino acid sequence |
MAAPPQPVPAPAAASPEVFRLGFIGPGNLAESIARGVAASGVLPATAIRTAPHRRPERAEAFSS IGAHILETNAQIIRPRNLPSTSTPFFSASSSSSSSSDPSQWRRRLSPCRRPRPRRRRCSGSGSS ARVTSRRASPAAWRRRASSRPPRSAPRHTAAPSAPRPSHPSELTSWRPTRRLLGLETYLPHPRH SSPPPPPPPPPRIPRNGGAASARAGARGRVAGGVPARVHRPG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |