Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0948400_circ_g.2 |
| ID in PlantcircBase | osa_circ_005816 |
| Alias | Os01circ33509/Os_ciR1723 |
| Organism | Oryza sativa |
| Position | chr1: 41720830-41721140 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, circseq_cup, find_circ |
| Parent gene | Os01g0948400 |
| Parent gene annotation |
Similar to Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C reductase). (Os01t0948400-01);Similar to pyrroline 5-carbo xylate reductase. (Os01t0948400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5/10/32/27 |
| Tissues | panicle/root/root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0948400-02:1 Os01t0948400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002685* osi_circ_011199 |
| PMCS | 0.484800589 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41721056-41720974(-) |
| Potential amino acid sequence |
MAAPPQPVPAPAAASPEVFRLGFIGPGNLAESIARGVAASGVLPATAIRTAPHRRPERAEAFSS IGAHILETNAQIIRPRNLPSTSTPFFSASSSSSSSSDPSQWRRRLSPCRRPRPRRRRCSGSGSS ARVTSRRASPAAWRRRASSRPPRSAPRHTAAPSAPRPSHPSELTSWRPTRRLLGLETYLPHPRH SSPPPPPPPPPRIPRNGGAASARAGARGRVAGGVPARVHRPG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |