Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d022272_circ_g.2 |
ID in PlantcircBase | zma_circ_009482 |
Alias | Zm07circ00095, zma_circ_0002592, GRMZM2G114575_C2 |
Organism | Zea mays |
Position | chr7: 174088744-174089077 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d022272 |
Parent gene annotation |
CBL-interacting serine/threonine-protein kinase 1 |
Parent gene strand | + |
Alternative splicing | Zm00001d022272_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d022272_T001:2 Zm00001d022272_T002:2 Zm00001d022272_T003:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.238431656 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
174088772-174089074(+) |
Potential amino acid sequence |
MVLEYVNGGELFDKIALKGKLTEKEGRKLFQQLIDAVGYCHEKGVCHRDLKVSASKTKIYMVLE YVNGGELFDKIALKGKLTEKEGRKLFQQLIDAVGYCHEKGVCHRDLKVSASKTKIYMVLEYVNG GELFDKIALKGKLTEKEGRKLFQQLIDAVGYCHEKGVCHRDLKVSASKTKIYMVLEYVNGGELF DKIALKGKLTEKEGRKLFQQLIDAVGYCHEKGVCHRDLK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |