Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d053275_circ_g.2 |
| ID in PlantcircBase | zma_circ_008264 |
| Alias | Zm04circ00100, zma_circ_0001605, GRMZM2G461808_C1 |
| Organism | Zea mays |
| Position | chr4: 223800276-223800983 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d053275 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Zm00001d053275_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d053275_T001:2 Zm00001d053275_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.073280186 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
223800966-223800361(+) 223800943-223800278(-) |
| Potential amino acid sequence |
MICFGSSFLPPSSKLPPFSQYHVLMIQRCKNCCLS*(+) MEDEVRQLQHEIIKINSNSYTVESLAHDTEKRVEALSLEVKKNSQSKSYSAGNIKSMEDEVRQL QHEIIKINSNSYTVESLAHDTEKRVEALSLEVKKNSQSKSYSAGNIKSMEDEVRQLQHEIIKIN SNSYTVESLAHDTEKRVEALSLEVKKNSQSKSYSAGNIKSMEDEVRQLQHEIIKINSNSYTVES LAHDTEKRVEALSLEVKK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |