Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d042777_circ_g.3 |
| ID in PlantcircBase | zma_circ_007731 |
| Alias | zma_circ_0001244 |
| Organism | Zea mays |
| Position | chr3: 179390515-179391264 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d042777 |
| Parent gene annotation |
Basic leucine zipper protein; Liguleless2 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d042777_circ_g.1 Zm00001d042777_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d042777_T006:2 Zm00001d042777_T013:1 Zm00001d042777_T004:2 Zm00001d042777_T012:2 Zm00001d042777_T011:2 Zm00001d042777_T008:2 Zm00001d042777_T014:1 Zm00001d042777_T007:2 Zm00001d042777_T001:1 Zm00001d042777_T010:2 Zm00001d042777_T009:2 Zm00001d042777_T005:2 Zm00001d042777_T003:2 Zm00001d042777_T002:2 Zm00001d042777_T015:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002548 osa_circ_004897 osi_circ_010951 |
| PMCS | 0.226806033 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
179391141-179391044(+) 179390587-179390586(+) |
| Potential amino acid sequence |
MITATSQASPLRPLLPPRRAFSSTTRSRCSCTEEREGETMTSSGRISRGRWHRQAPHAGDLPFV ANEAPTAAAQWEFAVSREHRH*(+) MRHQQQLHSGNSQSVGSTGTDSSSAQNTMSQMELVSPASSAPRQEVMMVTTDDYSYKPGLAAAP AAAAPPSFQQHHPLPLQLHGGEGGGDHDKQRQDISRALAPAGPPRWRSSLRGQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |