Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d042777_circ_g.3 |
ID in PlantcircBase | zma_circ_007731 |
Alias | zma_circ_0001244 |
Organism | Zea mays |
Position | chr3: 179390515-179391264 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d042777 |
Parent gene annotation |
Basic leucine zipper protein; Liguleless2 |
Parent gene strand | + |
Alternative splicing | Zm00001d042777_circ_g.1 Zm00001d042777_circ_g.2 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d042777_T006:2 Zm00001d042777_T013:1 Zm00001d042777_T004:2 Zm00001d042777_T012:2 Zm00001d042777_T011:2 Zm00001d042777_T008:2 Zm00001d042777_T014:1 Zm00001d042777_T007:2 Zm00001d042777_T001:1 Zm00001d042777_T010:2 Zm00001d042777_T009:2 Zm00001d042777_T005:2 Zm00001d042777_T003:2 Zm00001d042777_T002:2 Zm00001d042777_T015:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002548 osa_circ_004897 osi_circ_010951 |
PMCS | 0.226806033 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
179391141-179391044(+) 179390587-179390586(+) |
Potential amino acid sequence |
MITATSQASPLRPLLPPRRAFSSTTRSRCSCTEEREGETMTSSGRISRGRWHRQAPHAGDLPFV ANEAPTAAAQWEFAVSREHRH*(+) MRHQQQLHSGNSQSVGSTGTDSSSAQNTMSQMELVSPASSAPRQEVMMVTTDDYSYKPGLAAAP AAAAPPSFQQHHPLPLQLHGGEGGGDHDKQRQDISRALAPAGPPRWRSSLRGQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |