Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0224800_circ_g.3 |
ID in PlantcircBase | osa_circ_013952 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 7009011-7009912 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0224800 |
Parent gene annotation |
Ndr family protein. (Os02t0224800-01);Similar to predicted prote in. (Os02t0224800-02) |
Parent gene strand | + |
Alternative splicing | Os02g0224800_circ_g.1 Os02g0224800_circ_g.2 Os02g0224800_circ_g.4 Os02g0224800_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0224800-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.162791731 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7009025-7009160(+) |
Potential amino acid sequence |
MCLGVSAGAYILTLFAAKYRDRVLGLILVSPLCKPPTWTEWFYNKVASNLLYYYGMCGLVKEGL LQRYFSKEVRGCSDLPESDIVQACRSLLDQRQSMNVWRFVQTMNMRYDLTEDLKQLQCRTLIFV GEYSQFHTEAVHMTSKLDRRYCALVEVRFRNVLRCQCGCLHSYSLRSEV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |