Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G162800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000283 |
| Alias | Chr03:43211998|43213984 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 43211998-43213984 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G162800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.003G162800.4:3 Gorai.003G162800.3:4 Gorai.003G162800.6:3 Gorai.003G162800.8:3 Gorai.003G162800.1:4 Gorai.003G162800.7:3 Gorai.003G162800.5:3 Gorai.003G162800.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.098588613 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43212083-43212014(+) |
| Potential amino acid sequence |
MDKFSDVVNWLKANAANGDSLSAAESHKNESKNVPETKNTENKFFQGKIGFTPTSTTTSLIPGS TTLSFSPGTTTMSFSPGTTAGMFSLNTTTTRSTPADMTKKFPPLGTTTSFTSASSTTSFTPVGL TTSSMAAGSNSSFSFGLSTANFTSSSTTNSFTSSNMTSGFASPWSTGAFSNSQSPFLFGTQSSV SVDNNAADDADDVGCNHN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |