Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d053565_circ_g.1 |
ID in PlantcircBase | zma_circ_008283 |
Alias | zma_circ_0001713 |
Organism | Zea mays |
Position | chr4: 234510118-234511842 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d053565 |
Parent gene annotation |
Serine/threonine protein phosphatase 2A 55 kDa regulatory subuni t B beta isoform |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d053565_T008:3 Zm00001d053565_T002:3 Zm00001d053565_T009:3 Zm00001d053565_T005:3 Zm00001d053565_T015:2 Zm00001d053565_T004:2 Zm00001d053565_T007:3 Zm00001d053565_T021:2 Zm00001d053565_T013:3 Zm00001d053565_T016:3 Zm00001d053565_T017:2 Zm00001d053565_T014:3 Zm00001d053565_T018:2 Zm00001d053565_T012:3 Zm00001d053565_T006:3 Zm00001d053565_T019:2 Zm00001d053565_T011:3 Zm00001d053565_T010:2 Zm00001d053565_T001:2 Zm00001d053565_T003:3 Zm00001d053565_T020:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.064765338 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
234510222-234510144(+) 234510137-234511782(-) |
Potential amino acid sequence |
MEDLTEVITCAEFHPTHCNTLAYSSSKGTIRLIDLRQSALCDNHAKLFEEHEAPGSRSFFTEII ASVSDIKFARDGRHILSRDYMTLKRWRNVHISR*(+) MNVSPSLECHIITTKNVSSIPCKFYI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |