Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0510100_circ_g.2 |
| ID in PlantcircBase | osa_circ_001887 |
| Alias | Os_ciR5787 |
| Organism | Oryza sativa |
| Position | chr1: 17905649-17906935 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0510100 |
| Parent gene annotation |
MAP kinase kinase 1. (Os01t0510100-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0510100_circ_g.3 Os01g0510100_circ_g.4 Os01g0510100_circ_g.5 Os01g0510100_circ_g.6 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0510100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.157485936 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17906126-17905675(+) 17905667-17906820(-) |
| Potential amino acid sequence |
MDDLEMIQVIGKGSGGIVQLVRHKWVGTLYALKGIQMNIQEAVRKQIVQELKINQATQNAHIVL CHQSFYHNGVIYLVLEYMDRGSLADIIKQVKTILEPYLAVLCKQDREWYIQGW*(+) MYHSRSCLQSTARYGSRIVLTCLMISARDPRSMYSRTRYITPLW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |