Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | LOC18051719_circ_g.1 |
| ID in PlantcircBase | ptr_circ_000121 |
| Alias | circRNA121 |
| Organism | Poncirus trifoliata |
| Position | chrNW_006262688.1: 36361948-36364253 JBrowse» |
| Reference genome | Citrus_clementina_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | LOC18051719 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | shoots |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | XM_024192113.1:5 XM_024192114.1:5 XM_006449938.2:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36363880-36364250(-) 36364226-36363097(+) |
| Potential amino acid sequence |
MFSSSFAAAMYLKVNNFPQENKVYVIGGEGILEELRQAGYTGLGGPEDGEKRVQLKSNCLFEHD KNV*(-) MSLSPFQITHSYHVQISNLISVVPSFPHLLGHQDLYIQLAAALLICLHHQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | playing an important role in the early flowering process |
| Other Information | |
|---|---|
| References | Zeng et al., 2018 |