Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.012G069000_circ_g.1 |
| ID in PlantcircBase | gra_circ_001317 |
| Alias | Chr12:10120134|10120787 |
| Organism | Gossypium raimondii |
| Position | chrChr12: 10120134-10120787 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.012G069000 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.012G069000.1:2 Gorai.012G069000.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.844366998 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10120207-10120169(+) |
| Potential amino acid sequence |
MISRSSSGLNQEGNILASIQGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGK SSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIKDNIAYGRDATFD QIEEAAKIARAHTFISSLERGYETQWAEPSCNKFLFL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |