Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_20G248000_circ_g.2 |
| ID in PlantcircBase | gma_circ_007832 |
| Alias | gma-circRNA2834 |
| Organism | Glycine max |
| Position | chr20: 47739184-47741408 JBrowse» |
| Reference genome | v2.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_20G248000 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_20G248000_circ_g.1 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRG93101:4 KRG93106:4 KRG93097:4 KRG93098:4 KRG93107:4 KRG93096:4 KRG93102:4 KRG93105:4 KRG93104:4 KRG93103:4 KRG93099:4 KRG93100:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.184437307 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
47741357-47741365(-) |
| Potential amino acid sequence |
MEAPEMKIREAEALHKFAEAAYTGPLLDVGRNPFVFPCAWLYRQGILSPWTRNRRPVLDGDNWW RGHAAAFLKYVNLPPEALRHGRVSQVKCEAAYFIVVLHQLQSVVIAIRGTETPEDLITDGLCKE CTLSVDDLAGLINFSFTSKPWKLYRIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |