Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G63460_circ_g.5 |
| ID in PlantcircBase | ath_circ_028972 |
| Alias | AT3G63460_C1, AT3G63460_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 23432870-23433083 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT3G63460 |
| Parent gene annotation |
Protein transport protein SEC31 homolog B |
| Parent gene strand | - |
| Alternative splicing | AT3G63460_circ_g.6 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G63460.1:1 AT3G63460.2:1 AT3G63460.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.432021923 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23433079-23433015(-) |
| Potential amino acid sequence |
MEKTLVLALATGNKKFSASLCKLFESYAEILASQGLLTTAMKYLKVLDSGGLSPELSILRDRIS LSAEPGSYGEDSCPCFGNWQQKVQRISV* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |