Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0256500_circ_g.3 |
| ID in PlantcircBase | osa_circ_027187 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 9524437-9525386 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder |
| Parent gene | Os05g0256500 |
| Parent gene annotation |
Protein kinase, catalytic domain domain containing protein. (Os0 5t0256500-00) |
| Parent gene strand | + |
| Alternative splicing | Os05g0256100_circ_ag.1 Os05g0256100_circ_g.2 Os05g0256100_circ_ag.3 Os05g0256500_circ_g.1 Os05g0256500_circ_g.2 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0256500-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.125276711 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9525380-9524480(+) 9525329-9525356(-) |
| Potential amino acid sequence |
MSRFLGNNSLTGNLPDVISPSLKTIIRISRFSRLAKLRKEDFRHICPGFLGTIALQEICQML*( +) MRIIVFNEGLITSGKFPVRLLFPRNLDIYVENPLS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |