Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0854800_circ_g.3 |
| ID in PlantcircBase | osa_circ_022781 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 36002778-36002963 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0854800 |
| Parent gene annotation |
Similar to Poly polymerase catalytic domain containing protein, expressed. (Os03t0854800-01);Hypothetical conserved gene. (Os03t 0854800-02);Similar to Poly polymerase catalytic domain containi ng protein, expressed. (Os03t0854800-03) |
| Parent gene strand | - |
| Alternative splicing | Os03g0854800_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0854800-03:1 Os03t0854800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.141182796 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36002813-36002790(+) 36002914-36002780(-) |
| Potential amino acid sequence |
MSERGTLAEIAAKSIEKGIQGELGDLGLGARPSIHACCSSPEDAMVCRLSSLNSS*(+) MLGRAPSPRSPSSPWMPFSMLFAAISAKVPRSDMDLVHKYYEEFKDDSLQTIASSGDEQQACML GRAPSPRSPSSPWMPFSMLFAAISAKVPRSDMDLVHKYYEEFKDDSLQTIASSGDEQQACMLGR APSPRSPSSPWMPFSMLFAAISAKVPRSDMDLVHKYYEEFKDDSLQTIASSGDEQQACMLGRAP SPRSPSSPWMPFSMLFAAISAKVPRSDMDLVHKYYEEFK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |