Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Cotton_A_11754_circ_g.1 |
| ID in PlantcircBase | gar_circ_000852 |
| Alias | CA_chr7_BGI-A2_v1.0:106056718|106057042 |
| Organism | Gossypium arboreum |
| Position | chrCA_chr7_BGI-A2_v1.0: 106056718-106057042 JBrowse» |
| Reference genome | BGI-A2_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Cotton_A_11754 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4/8 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Cotton_A_11754:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000058 gra_circ_001353 |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
106056738-106056853(-) 106056966-106057012(-) 106057025-106056828(+) |
| Potential amino acid sequence |
MLGKEFFVGGKSMERSFETCIRVNSQGKPVVHNENSKKPQ*(-) MKTRRNRSEVETELGLLFSKGGKRSSGFGNKTEQPRSGTKFEMLVEDVREGVLCWRQIHGEIL* (-) MDLPPTKNSFPNILHQHLKLSTRSRLFGFVSEPRTPLSSFRKQ*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |