Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Cotton_A_11754_circ_g.1 |
ID in PlantcircBase | gar_circ_000852 |
Alias | CA_chr7_BGI-A2_v1.0:106056718|106057042 |
Organism | Gossypium arboreum |
Position | chrCA_chr7_BGI-A2_v1.0: 106056718-106057042 JBrowse» |
Reference genome | BGI-A2_v1.0 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Cotton_A_11754 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4/8 |
Tissues | leaf/ovule |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Cotton_A_11754:2 |
Conservation Information | |
---|---|
Conserved circRNAs | ghi_circ_000058 gra_circ_001353 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
106056738-106056853(-) 106056966-106057012(-) 106057025-106056828(+) |
Potential amino acid sequence |
MLGKEFFVGGKSMERSFETCIRVNSQGKPVVHNENSKKPQ*(-) MKTRRNRSEVETELGLLFSKGGKRSSGFGNKTEQPRSGTKFEMLVEDVREGVLCWRQIHGEIL* (-) MDLPPTKNSFPNILHQHLKLSTRSRLFGFVSEPRTPLSSFRKQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |