Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0122200_circ_g.7 |
ID in PlantcircBase | osa_circ_012869 |
Alias | Os_ciR7639 |
Organism | Oryza sativa |
Position | chr2: 1172034-1172864 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os02g0122200 |
Parent gene annotation |
Similar to predicted protein. (Os02t0122200-00) |
Parent gene strand | - |
Alternative splicing | Os02g0122200_circ_g.1 Os02g0122200_circ_g.2 Os02g0122200_circ_g.3 Os02g0122200_circ_g.4 Os02g0122200_circ_g.5 Os02g0122200_circ_g.6 Os02g0122200_circ_g.8 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0122200-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.130766376 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1172825-1172036(-) |
Potential amino acid sequence |
MFLSIATSNMVATSLAKKDEELAQHQVSMLLFVALTCGLGMFLFTKLFGTQVLTGPGTVFCDYL CYIFMFLSIATSNMVATSLAKKDEELAQHQVSMLLFVALTCGLGMFLFTKLFGTQVLTGPGTVF CDYLCYIFMFLSIATSNMVATSLAKKDEELAQHQVSMLLFVALTCGLGMFLFTKLFGTQVLTGP GTVFCDYLCYIFMFLSIATSNMVATSLAKKDEELAQHQVSMLLFVALTCGLGMFLFTKLFGTQV LT(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |