Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d028409_circ_g.2 |
ID in PlantcircBase | zma_circ_006456 |
Alias | zma_circ_0000610, GRMZM2G042253_C1 |
Organism | Zea mays |
Position | chr1: 33802401-33802635 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d028409 |
Parent gene annotation |
Chaperonin 60 subunit beta 4 chloroplastic |
Parent gene strand | - |
Alternative splicing | Zm00001d028409_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d028409_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.240912292 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33802520-33802624(-) |
Potential amino acid sequence |
MADLIKNKLKGTIKVAAVKAFSFGEQKTQCLDDIAIMTGDTIG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |