Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0543400_circ_g.2 |
| ID in PlantcircBase | osa_circ_028731 |
| Alias | Os_ciR10077 |
| Organism | Oryza sativa |
| Position | chr5: 26967107-26967823 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0543400 |
| Parent gene annotation |
Similar to Farnesyl diphosphate synthase (Fragment). (Os05t05434 00-01);Similar to Farnesyl diphosphate synthase (Fragment). (Os0 5t0543400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0543400-01:5 Os05t0543400-02:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015714 |
| PMCS | 0.165111204 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26967784-26967125(+) 26967602-26967802(-) |
| Potential amino acid sequence |
MNSRMSYIEQCGGDSRFSSL*(+) MGIYFQVQDDYLDCYGDPKFIGKIGTDIEDYKCSWLVVQALERADESQKSVLFENYGKKDPACV AKVKSLYRELNLESPPHCSI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |