Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0543400_circ_g.2 |
ID in PlantcircBase | osa_circ_028731 |
Alias | Os_ciR10077 |
Organism | Oryza sativa |
Position | chr5: 26967107-26967823 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os05g0543400 |
Parent gene annotation |
Similar to Farnesyl diphosphate synthase (Fragment). (Os05t05434 00-01);Similar to Farnesyl diphosphate synthase (Fragment). (Os0 5t0543400-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0543400-01:5 Os05t0543400-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015714 |
PMCS | 0.165111204 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26967784-26967125(+) 26967602-26967802(-) |
Potential amino acid sequence |
MNSRMSYIEQCGGDSRFSSL*(+) MGIYFQVQDDYLDCYGDPKFIGKIGTDIEDYKCSWLVVQALERADESQKSVLFENYGKKDPACV AKVKSLYRELNLESPPHCSI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |