Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0560900_circ_g.1 |
| ID in PlantcircBase | osa_circ_040193 |
| Alias | Os_ciR11944 |
| Organism | Oryza sativa |
| Position | chr9: 22290178-22290298 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0560900 |
| Parent gene annotation |
Zinc finger, C2H2-like domain containing protein. (Os09t0560900- 01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0560900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.083333333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22290221-22290251(+) 22290258-22290195(+) 22290241-22290277(-) |
| Potential amino acid sequence |
MPAGLGITGGLSDGTSTLATFDEGSSYRWSYTIGRSWRIYHARWIGHNRRP*(+) MALPLWLPSMKGLPIGGATP*(+) MPNPAGMVYPPRPAYGVAPPIGRPFIEGSQSGSAIAKASCYAQSSGHGISSTTGLWCSSTYRKT LHRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |