Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_13G216800_circ_g.1 |
| ID in PlantcircBase | gma_circ_006979 |
| Alias | gma-circRNA1848 |
| Organism | Glycine max |
| Position | chr13: 32983666-32983957 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_13G216800 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH21044:1 KRH21043:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.208595434 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32983787-32983676(+) 32983893-32983676(+) 32983689-32983913(-) 32983673-32983900(-) |
| Potential amino acid sequence |
MDLPEAYENWESFKEKLQSRGITPFCMSAVKREGTHEVICAAYELLRKSKEDKEEYEGTCC*(+ ) MKLSVLLMSFCVKVKKTRRNMKVHVVDGSSQQPDLEFDAVRLELKLFNPELAEKPYVVAFNKMD LPEAYENWESFKEKLQSRGITPFCMSAVKREGTHEVICAAYELLRKSKEDKEEYEGTCC*(+) MNHQQHVPSYSSLSSLLLRKSS*(-) MYLHIPPCLLYFYAKAHKQHR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |