Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0526300_circ_g.3 |
| ID in PlantcircBase | osa_circ_037775 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 26183709-26184160 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0526300 |
| Parent gene annotation |
Similar to cDNA clone:001-038-D09, full insert sequence. (Os08t0 526300-01);tRNA-binding arm domain containing protein. (Os08t052 6300-02);tRNA-binding arm domain containing protein. (Os08t05263 00-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0526300-02:3 Os08t0526300-03:3 Os08t0526300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.35382772 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26183796-26183711(-) |
| Potential amino acid sequence |
MALVIACATQNIRGSAANHVKMKLKGSGNEVIFNQASAVSGSVINRDAESYTNELLQFAHFTLF LAPPLGTDSIVPKKERFSLPQFGHGPFKIKKSFTMALVIACATQNIRGSAANHVKMKLKGSGNE VIFNQASAVSGSVINRDAESYTNELLQFAHFTLFLAPPLGTDSIVPKKERFSLPQFGHGPFKIK KSFTMALVIACATQNIRGSAANHVKMKLKGSGNEVIFNQASAVSGSVINRDAESYTNELLQFAH FTLFLAPPLGTDSIVPKKERFSLPQFGHGPFKIKKSFTMALVIACATQNIRGSAANHVKMKLKG SG(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |