Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G45910_circ_g.5 |
ID in PlantcircBase | ath_circ_018606 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 18895387-18895491 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, CIRI-full |
Parent gene | AT2G45910 |
Parent gene annotation |
U-box domain-containing protein 33 |
Parent gene strand | + |
Alternative splicing | AT2G45910_circ_g.1 AT2G45910_circ_g.2 AT2G45910_circ_g.3 AT2G45910_circ_g.4 AT2G45910_circ_g.6 |
Support reads | 1 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G45910.2:1 AT2G45910.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.192060317 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18895456-18895488(+) |
Potential amino acid sequence |
MVYLQRILDTYKENDGSEVQESHLRTPRSTYSLSNMVYLQRILDTYKENDGSEVQESHLRTPRS TYSLSNMVYLQRILDTYKENDGSEVQESHLRTPRSTYSLSNMVYLQRILDTYK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |