Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G45910_circ_g.5 |
| ID in PlantcircBase | ath_circ_018606 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18895387-18895491 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, CIRI-full |
| Parent gene | AT2G45910 |
| Parent gene annotation |
U-box domain-containing protein 33 |
| Parent gene strand | + |
| Alternative splicing | AT2G45910_circ_g.1 AT2G45910_circ_g.2 AT2G45910_circ_g.3 AT2G45910_circ_g.4 AT2G45910_circ_g.6 |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G45910.2:1 AT2G45910.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.192060317 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18895456-18895488(+) |
| Potential amino acid sequence |
MVYLQRILDTYKENDGSEVQESHLRTPRSTYSLSNMVYLQRILDTYKENDGSEVQESHLRTPRS TYSLSNMVYLQRILDTYKENDGSEVQESHLRTPRSTYSLSNMVYLQRILDTYK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |