Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G46020_circ_g.2 |
| ID in PlantcircBase | ath_circ_018634 |
| Alias | AT2G46020_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18927927-18928130 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, CIRI2 |
| Parent gene | AT2G46020 |
| Parent gene annotation |
ATP-dependent helicase BRM |
| Parent gene strand | + |
| Alternative splicing | AT2G46020_circ_g.3 |
| Support reads | 15 |
| Tissues | aerial, whole_plant, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G46020.1:1 AT2G46020.6:1 AT2G46020.4:1 AT2G46020.3:1 AT2G46020.5:1 AT2G46020.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.866345822 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18927939-18928127(+) |
| Potential amino acid sequence |
MKFNVLVTTYEFIMYDRSKLSKVDWKYIIIDEAQRMKDRESVLARDLDRYRCQRRLLLTGTPLQ EVCAMKFNVLVTTYEFIMYDRSKLSKVDWKYIIIDEAQRMKDRESVLARDLDRYRCQRRLLLTG TPLQEVCAMKFNVLVTTYEFIMYDRSKLSKVDWKYIIIDEAQRMKDRESVLARDLDRYRCQRRL LLTGTPLQEVCAMKFNVLVTTYEFIMYDRSKLSKVDWKYIIIDEAQRMKDRESVLARDLDRYRC QRRLLLTGTPLQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |