Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0373700_circ_g.1 |
| ID in PlantcircBase | osa_circ_027678 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 18012847-18012931 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0373700 |
| Parent gene annotation |
Similar to Nascent polypeptide-associated complex alpha subunit- like protein 3 (NAC-alpha-like protein 3) (Alpha-NAC-like protei n 3). (Os05t0373700-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0373700_circ_igg.1 |
| Support reads | 1 |
| Tissues | anther |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0373700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.526469804 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18012852-18012851(+) |
| Potential amino acid sequence |
MSQSLLKMTMTMKMMTTRMTKMTMMRRGDEPVVVEDDDDDEDDDDEDDKDDDDAEGR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |