Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0198200_circ_g.2 |
ID in PlantcircBase | osa_circ_000732 |
Alias | Os_ciR6543 |
Organism | Oryza sativa |
Position | chr1: 5329611-5329768 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0198200 |
Parent gene annotation |
Similar to Casein kinase-like protein. (Os01t0198200-01);Similar to predicted protein. (Os01t0198200-02);Similar to predicted pr otein. (Os01t0198200-03) |
Parent gene strand | - |
Alternative splicing | Os01g0198200_circ_g.1 Os01g0198200_circ_g.3 Os01g0198200_circ_g.4 Os01g0198200_circ_g.5 Os01g0198200_circ_g.6 Os01g0198200_circ_g.7 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0198200-02:1 Os01t0198200-01:1 Os01t0198200-03:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.613449209 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5329728-5329727(+) 5329686-5329734(-) 5329718-5329738(-) 5329642-5329738(-) |
Potential amino acid sequence |
MNHLLCRIAVHMAFLMCETSVPGHNHSPSASCCGQGSDIEPLLPLFVYPFEGK*(+) MSLPWPQQEADGLWLCPGTLVSHIRNAICTAILQSK*(-) MDKQKVEGGVLCHCLGHSRKPMGCGYVPERWFHTSGTPYAQQSYKVSDSFPFKWINKKWKEGFY VTALATAGSRWAVVMSRNAGFTHQERHMHSNPTK*(-) MSRNAGFTHQERHMHSNPTK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |