Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0420900_circ_g.3 |
ID in PlantcircBase | osa_circ_006840 |
Alias | Os_ciR1501 |
Organism | Oryza sativa |
Position | chr10: 14835972-14836371 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os10g0420900 |
Parent gene annotation |
Conserved hypothetical protein. (Os10t0420900-01) |
Parent gene strand | - |
Alternative splicing | Os10g0420900_circ_g.1 Os10g0420900_circ_g.2 Os10g0420900_circ_g.4 |
Support reads | 8/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0420900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008420 |
PMCS | 0.228749896 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14836196-14836198(+) 14836178-14836368(-) |
Potential amino acid sequence |
MLIIDPHISLVSFEANCQLCSSYCAAYTSDCGALLDLNISLHCSIRLLVPNGLEDFVGPWYMQF FTISSVSVSC*(+) MVKNCIYQGPTKSSRPFGTRSLMEQCNEILRSRRAPQSEV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |