Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0169500_circ_g.4 |
| ID in PlantcircBase | osa_circ_000448 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 3567075-3570636 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0169500 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os01t0169500-01) ;Hypothetical conserved gene. (Os01t0169500-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0169500_circ_g.3 Os01g0169500_circ_g.5 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0169500-02:4 Os01t0169500-01:10 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112427337 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3570626-3567122(+) 3567093-3570467(-) |
| Potential amino acid sequence |
MILLLRFPFMKDVLRGKIES*(+) MKGNLSSNIISAKLCSICFGNAPKNWYFCCSVLGSSWCNRPKTGYAVVGTYPLLYEGPVQQQ*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |