Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_17G196500_circ_g.2 |
| ID in PlantcircBase | gma_circ_009504 |
| Alias | circRNA3015 |
| Organism | Glycine max |
| Position | chr17: 30754516-30755046 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | CIRI, CIRCexplorer |
| Parent gene | GLYMA_17G196500 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | pod |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH04927:1 KRH04928:1 KRH04926:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.166532564 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30754576-30754880(-) |
| Potential amino acid sequence |
MVLLKLLKNLPKGTRRRIRSCSSGRSRLHQSLSRRTPRHLSPAPPSNFELVFSSLQELPRSATR RRLVISVCSLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021a |