Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0462600_circ_g.3 |
ID in PlantcircBase | osa_circ_028170 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 22730518-22731741 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0462600 |
Parent gene annotation |
SAC3/GANP family protein. (Os05t0462600-01);SAC3/GANP family pro tein. (Os05t0462600-02) |
Parent gene strand | - |
Alternative splicing | Os05g0462600_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0462600-01:4 Os05t0462600-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.220838916 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22731401-22731659(-) 22730601-22731652(-) |
Potential amino acid sequence |
MVIPKSEKKILGADLSKKPAYVSVSMVKNDARSLPFSLHNYATRNLNCCKDEAQKAACQSMIEE IKNSAIADGTLLTKNWDTEPLLPLVQNVATIPETRLQVVQGLKINISTRRTLRCWKTSMLAR*( -) MEPFLLRIGTLSHCFLWYKMLQPFQKQGFRWSRASRSIYQPGARSGVGKPVCWPGSR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |