Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0572900_circ_g.2 |
| ID in PlantcircBase | osa_circ_020511 |
| Alias | Os03circ18825 |
| Organism | Oryza sativa |
| Position | chr3: 20871072-20871703 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ei-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os03g0572925 |
| Parent gene annotation |
Hypothetical protein. (Os03t0572925-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/4 |
| Tissues | leaf and panicle/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0572900-01:1 Os03t0572900-01:1 Os03t0572925-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004918* osi_circ_013221 |
| PMCS | 0.432179088 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20871640-20871123(+) 20871699-20871603(-) |
| Potential amino acid sequence |
MSYLCAPNACPHSVSTALPIPSTQIGHPMQVQGSGVGRR*(+) MGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITGVPLAVIYGFSEPILVFMGQSPEIARAAA IFVYGLIPQIFAYAINFPIQKYMQAQSIVLPSAYISAATLALHVLLSWVVVYKVGLGLLGASLV LSISWWVIVAAQFAYIVTSPTCRHTWTGFTWQAFAGLWDFLKLSAASAVMLCLESWYFQVLVLI AGLLPNPELALDALSVCSEWVAPWRRCAGRRSVHTSTTCWESTCSAPPCS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |