Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0216300_circ_g.57 |
| ID in PlantcircBase | osa_circ_013875 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 6513669-6513827 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0216300 |
| Parent gene annotation |
Similar to cDNA clone:J023088C01, full insert sequence. (Os02t02 16300-01);Similar to cDNA clone:J023088C01, full insert sequence . (Os02t0216300-04);Similar to cDNA clone:J023088C01, full inser t sequence. (Os02t0216300-05);Similar to cDNA clone:J023088C01, full insert sequence. (Os02t0216300-07);Similar to cDNA clone:00 1-032-A03, full insert sequence. (Os02t0216300-09) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GG-AC |
| Number of exons covered | Os02t0216300-09:1 Os02t0216300-07:1 Os02t0216300-04:1 Os02t0216300-05:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.351025943 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6513790-6513755(+) |
| Potential amino acid sequence |
MCHKRKTVTNCCHRKKITAAAEAASRHKAQDQARSRDAGAVW*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |