Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d038224_circ_g.2 |
| ID in PlantcircBase | zma_circ_009121 |
| Alias | Zm06circ00084, zma_circ_0002284, GRMZM2G153075_C1 |
| Organism | Zea mays |
| Position | chr6: 151976978-151977263 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d038224 |
| Parent gene annotation |
F-box protein SKP2A |
| Parent gene strand | + |
| Alternative splicing | Zm00001d038224_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d038224_T002:1 Zm00001d038224_T003:1 Zm00001d038224_T005:1 Zm00001d038224_T004:1 Zm00001d038224_T001:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.462102464 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
151977177-151976994(+) 151977008-151977029(+) 151977193-151977255(-) |
| Potential amino acid sequence |
MIGWSSWRLVFAQAGVTRWDGGSLIFHLHGNSLVV*(+) MVSGRPHGELDSWFKSLMVTSSSERGQAGSGGPAPTLTGWKDLPMELLVRIISTVGDDRMVIVA SGVCTGWRDALGWGVTNLSLTWKQLGSITTEDGQWEAAW*(+) MTILSSPTVDIIRTRSSIGRSFHPVNVGAGPPLPACPLSLLEVTMRLLNHESNSPCGLPLTIFS GYTTKLFPCK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |