Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038224_circ_g.2 |
ID in PlantcircBase | zma_circ_009121 |
Alias | Zm06circ00084, zma_circ_0002284, GRMZM2G153075_C1 |
Organism | Zea mays |
Position | chr6: 151976978-151977263 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d038224 |
Parent gene annotation |
F-box protein SKP2A |
Parent gene strand | + |
Alternative splicing | Zm00001d038224_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d038224_T002:1 Zm00001d038224_T003:1 Zm00001d038224_T005:1 Zm00001d038224_T004:1 Zm00001d038224_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.462102464 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
151977177-151976994(+) 151977008-151977029(+) 151977193-151977255(-) |
Potential amino acid sequence |
MIGWSSWRLVFAQAGVTRWDGGSLIFHLHGNSLVV*(+) MVSGRPHGELDSWFKSLMVTSSSERGQAGSGGPAPTLTGWKDLPMELLVRIISTVGDDRMVIVA SGVCTGWRDALGWGVTNLSLTWKQLGSITTEDGQWEAAW*(+) MTILSSPTVDIIRTRSSIGRSFHPVNVGAGPPLPACPLSLLEVTMRLLNHESNSPCGLPLTIFS GYTTKLFPCK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |