Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_19G260700_circ_g.1 |
| ID in PlantcircBase | gma_circ_007702 |
| Alias | gma-circRNA2678 |
| Organism | Glycine max |
| Position | chr19: 50387173-50387829 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_19G260700 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_19G260700_circ_g.2 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRG97257:2 KRG97256:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.203707116 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
50387790-50387523(+) 50387713-50387760(-) |
| Potential amino acid sequence |
MEYPLPELNLSAPTFIKMASPLGTFSNISPPTCSTPG*(+) MINHTTIVMKKVLECYKGFENIKMLVDVGGGLGININLITSKYPHIQGINFDLPHVLEHAPSYP GVEHVGGDMFENVPKGDAIFMKVGAERFNSGRGYSIQQGLWHSCF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | cytoplasmic male sterility (with protein-coding potential) |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |