Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0720000_circ_g.3 |
| ID in PlantcircBase | osa_circ_032391 |
| Alias | Os_ciR10651 |
| Organism | Oryza sativa |
| Position | chr6: 30591203-30591717 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os06g0720000 |
| Parent gene annotation |
Conserved hypothetical protein. (Os06t0720000-01);Conserved hypo thetical protein. (Os06t0720000-02);Similar to H0124E07.1 protei n. (Os06t0720000-03) |
| Parent gene strand | + |
| Alternative splicing | Os06g0720000_circ_g.1 Os06g0720000_circ_g.2 |
| Support reads | 2/3 |
| Tissues | root/root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0720000-02:3 Os06t0720000-01:3 Os06t0720000-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.205096958 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30591472-30591241(+) 30591277-30591700(-) |
| Potential amino acid sequence |
MRRPTLQLLLPRVATTFRGRGGILLRTRDPSEGAKPGGLGRVSPPQRRQRLVTSDDRREVWTAT PWDSLSAR*(+) MSLAAEGALIITWPTSCPTVSLSRLLADRH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |