Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G209900_circ_g.1 |
| ID in PlantcircBase | gra_circ_001448 |
| Alias | Chr13:52163929|52164278 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 52163929-52164278 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G209900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.013G209900.2:1 Gorai.013G209900.1:1 Gorai.013G209900.3:1 Gorai.013G209900.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.441904762 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
52164276-52164259(-) 52163966-52164234(-) |
| Potential amino acid sequence |
MATKKIIAICQSGGEFETENDGSLSYRGGDAHAIDIDDQMKFSDFKMEVAEMFNCSFGAMSIKY FLPGNRKTLITVSNDKDLERMIKFHGDSITADVYIVMEENGAADVSNMSDSRSWLQRR*(-) MELLMFLTCQIVGHGYKEDNSNLSIWR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |