Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014294_circ_g.6 |
ID in PlantcircBase | zma_circ_008453 |
Alias | Zm05circ00034, GRMZM2G377341_C1 |
Organism | Zea mays |
Position | chr5: 39812786-39812973 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d014294 |
Parent gene annotation |
Acetyl-CoA carboxylase 1 |
Parent gene strand | - |
Alternative splicing | Zm00001d014294_circ_g.4 Zm00001d014294_circ_g.5 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d014294_T004:1 Zm00001d014294_T005:1 Zm00001d014294_T020:1 Zm00001d014294_T011:1 Zm00001d014294_T028:1 Zm00001d014294_T033:1 Zm00001d014294_T018:1 Zm00001d014294_T008:1 Zm00001d014294_T007:1 Zm00001d014294_T002:1 Zm00001d014294_T015:1 Zm00001d014294_T009:1 Zm00001d014294_T003:1 Zm00001d014294_T001:1 Zm00001d014294_T017:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.401076146 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
39812931-39812933(+) 39812955-39812871(-) |
Potential amino acid sequence |
MVAAPMIHSIKASNLSTLPLVGLNPSSGSSLVTLTATQWPFGLTDCALSKSNLVATADIVLQLW *(+) MDHGGGYHNWRTISAVATKFDLDKAQSVRPKGHCVAVRVTSEDPDDGFKPTSGRVERLDAFMEW IMGAATIIGGQYLLLQLSLIWIKHSQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |