Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0753100_circ_g.3 |
| ID in PlantcircBase | osa_circ_003937 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 31600723-31603035 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0753100 |
| Parent gene annotation |
Alcohol dehydrogenase superfamily, zinc-containing protein. (Os0 1t0753100-01);Similar to reticulon-4-interacting protein 1. (Os0 1t0753100-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0753100_circ_g.1 Os01g0753100_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0753100-01:4 Os01t0753100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.223156644 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31602830-31600727(+) |
| Potential amino acid sequence |
MTLQGEAAALADRYGLAVGLPAATAVLLKKQMQYRYSHGIGG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |