Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0753100_circ_g.3 |
ID in PlantcircBase | osa_circ_003937 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 31600723-31603035 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0753100 |
Parent gene annotation |
Alcohol dehydrogenase superfamily, zinc-containing protein. (Os0 1t0753100-01);Similar to reticulon-4-interacting protein 1. (Os0 1t0753100-02) |
Parent gene strand | + |
Alternative splicing | Os01g0753100_circ_g.1 Os01g0753100_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0753100-01:4 Os01t0753100-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.223156644 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31602830-31600727(+) |
Potential amino acid sequence |
MTLQGEAAALADRYGLAVGLPAATAVLLKKQMQYRYSHGIGG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |