Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G141400_circ_g.1 |
| ID in PlantcircBase | gra_circ_000730 |
| Alias | Chr07:11729570|11732392 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 11729570-11732392 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G141400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.007G141400.3:6 Gorai.007G141400.1:6 Gorai.007G141400.2:6 Gorai.007G141400.4:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.112653787 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11729586-11729583(+) 11730063-11731827(-) |
| Potential amino acid sequence |
MVIRRNQVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDGLTHFLTYA DNNAVGYFIKQGFTKEIHLERDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRRQRQAIDEK IRELSNCQIVYPGIDFQKKEAGIPKKVVKVEDIPGLKAINL*(+) MIHQSCAITFYLFICCDCTESYFPELLADIWTICDATNNLITSDNHHRFMAFKPGISSTLTTFL GIPASFF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |