Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_07G126200_circ_g.1 |
| ID in PlantcircBase | gma_circ_001750 |
| Alias | Gm07circRNA10, circRNA1482 |
| Organism | Glycine max |
| Position | chr7: 15061682-15062019 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI, CIRI, CIRCexplorer |
| Parent gene | GLYMA_07G126200 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_07G126200_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, root, stem, pod |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH49009:1 KRH49008:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.675315943 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15061841-15061690(+) |
| Potential amino acid sequence |
MLRQGGHAVDAAVAAALCIGVVFSASSGIGGGAFMVVRSSSSSQTQAFDMRETAPLAASQLLD* (+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a; Ma et al., 2021a |