Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0566550_circ_g.5 |
| ID in PlantcircBase | osa_circ_040222 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 22605957-22606880 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0566550 |
| Parent gene annotation |
Similar to serine/threonine protein kinase 1, CTR1. (Os09t056655 0-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0566550_circ_g.3 Os09g0566550_circ_g.4 Os09g0566550_circ_g.6 Os09g0566550_circ_g.7 Os09g0566550_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0566550-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147680988 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22606882-22606869(-) |
| Potential amino acid sequence |
MLADKVNVPCRVVKGCKYCKSDDATSCLVRFGLEREYLVDLIGDPGQLSDPDSFVNGPYSLSVP SPLRPPKFRSLEITSNFSSVAKQYFSDCHSLNLLFNEASTGANSNAAVAMDQPYSTRKHDTRDD IMSSWVPVKDVSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |