Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0695100_circ_g.2 |
ID in PlantcircBase | osa_circ_035490 |
Alias | Os07circ21701 |
Organism | Oryza sativa |
Position | chr7: 29623154-29623862 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os07g0695100 |
Parent gene annotation |
Pseudo response regulator, Heading date, long-day repression (Os 07t0695100-01);Similar to Two-component response regulator-like PRR37. (Os07t0695100-02) |
Parent gene strand | + |
Alternative splicing | Os07g0695100_circ_g.3 |
Support reads | 2/1 |
Tissues | leaf/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0695100-02:3 Os07t0695100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007472* osi_circ_017535 |
PMCS | 0.337318253 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29623202-29623192(+) 29623725-29623824(-) |
Potential amino acid sequence |
MQNSIDLVLTEVVMPGVSGISLLSRIMNHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKP IRKNELKNLWQHVWRRCHSSSGSGSESGIQTQKCAKSKSGDESNNNNGSNDDDDDDGVIMGLNA RDGSDNGSGTQSSLLKMASKHGHI*(+) MPLSLPLPLELWHRLHTCCHRFLSSFLRMGLTKKSTAPFDKHLKTVPIASFEDIIITGIFLQIL WFMILLNREIPDTPGITTSVKTRSMLFCISSRYVHACWPFSAGMIECHCRYHCHLLH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |