Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0695100_circ_g.2 |
| ID in PlantcircBase | osa_circ_035490 |
| Alias | Os07circ21701 |
| Organism | Oryza sativa |
| Position | chr7: 29623154-29623862 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os07g0695100 |
| Parent gene annotation |
Pseudo response regulator, Heading date, long-day repression (Os 07t0695100-01);Similar to Two-component response regulator-like PRR37. (Os07t0695100-02) |
| Parent gene strand | + |
| Alternative splicing | Os07g0695100_circ_g.3 |
| Support reads | 2/1 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0695100-02:3 Os07t0695100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007472* osi_circ_017535 |
| PMCS | 0.337318253 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29623202-29623192(+) 29623725-29623824(-) |
| Potential amino acid sequence |
MQNSIDLVLTEVVMPGVSGISLLSRIMNHNICKNIPVIMMSSNDAMGTVFKCLSKGAVDFLVKP IRKNELKNLWQHVWRRCHSSSGSGSESGIQTQKCAKSKSGDESNNNNGSNDDDDDDGVIMGLNA RDGSDNGSGTQSSLLKMASKHGHI*(+) MPLSLPLPLELWHRLHTCCHRFLSSFLRMGLTKKSTAPFDKHLKTVPIASFEDIIITGIFLQIL WFMILLNREIPDTPGITTSVKTRSMLFCISSRYVHACWPFSAGMIECHCRYHCHLLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |