Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d042938_circ_g.3 |
ID in PlantcircBase | zma_circ_007744 |
Alias | Zm03circ00073, GRMZM2G386991_C1 |
Organism | Zea mays |
Position | chr3: 184561732-184562530 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d042938 |
Parent gene annotation |
Serine/threonine-protein kinase AFC1 |
Parent gene strand | + |
Alternative splicing | Zm00001d042938_circ_g.1 Zm00001d042938_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d042938_T005:4 Zm00001d042938_T006:4 Zm00001d042938_T003:4 Zm00001d042938_T004:4 Zm00001d042938_T002:4 Zm00001d042938_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.347701789 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
184561831-184561830(+) 184562009-184562526(-) |
Potential amino acid sequence |
MIEIDVLQRLGKHDFTGSRCVQIRNWFDYRNHICIVFEKLGPSLYDFLRKNSYRSFPIDLVREF ARQILESVAFMHDLRLIHTDLKPENILLVSSESIRVPDYKGHLVKFWSAGTWKTKKQWLSRLYA PFRNTERLL*(+) MITIVKPVPYLHTTAASKVMLPKSLEHINFYHSSLSVFLKGAYNLDSHCFLVFQVPALQNLTKC PL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |