Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0161600_circ_g.3 |
| ID in PlantcircBase | osa_circ_032853 |
| Alias | Os07circ02700/Os_ciR3162 |
| Organism | Oryza sativa |
| Position | chr7: 3291242-3291394 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os07g0161650 |
| Parent gene annotation |
Hypothetical protein. (Os07t0161650-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/4/2 |
| Tissues | leaf/root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0161600-01:1 Os07t0161600-01:1 Os07t0161650-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.629051743 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3291342-3291322(+) |
| Potential amino acid sequence |
MKNQDLLSKLFQISLVQIIELHVQSISFWDHGLTFSSPNPLHCLR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |