Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G44210_circ_g.5 |
ID in PlantcircBase | ath_circ_018313 |
Alias | At_ciR3794 |
Organism | Arabidpsis thaliana |
Position | chr2: 18281580-18281744 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, find_circ, CIRI-full |
Parent gene | AT2G44210 |
Parent gene annotation |
AT2G44210 protein |
Parent gene strand | + |
Alternative splicing | AT2G44210_circ_g.2 AT2G44210_circ_g.3 AT2G44210_circ_g.4 |
Support reads | 2/4 |
Tissues | leaf/whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G44210.2:1 AT2G44210.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.361086665 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18281589-18281741(+) |
Potential amino acid sequence |
MYVEDGVFYGAKAKINVWKPDVEMPNEFSLAQIWVLGGNFNSDLNSIEAGWQHAIMYVEDGVFY GAKAKINVWKPDVEMPNEFSLAQIWVLGGNFNSDLNSIEAGWQHAIMYVEDGVFYGAKAKINVW KPDVEMPNEFSLAQIWVLGGNFNSDLNSIEAGWQHAIMYVEDGVFYGAKAKINVWKPDVEMPNE FSLAQIWVLGGNFNSDLNSIEAGWQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |