Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G44210_circ_g.5 |
| ID in PlantcircBase | ath_circ_018313 |
| Alias | At_ciR3794 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18281580-18281744 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, find_circ, CIRI-full |
| Parent gene | AT2G44210 |
| Parent gene annotation |
AT2G44210 protein |
| Parent gene strand | + |
| Alternative splicing | AT2G44210_circ_g.2 AT2G44210_circ_g.3 AT2G44210_circ_g.4 |
| Support reads | 2/4 |
| Tissues | leaf/whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G44210.2:1 AT2G44210.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.361086665 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18281589-18281741(+) |
| Potential amino acid sequence |
MYVEDGVFYGAKAKINVWKPDVEMPNEFSLAQIWVLGGNFNSDLNSIEAGWQHAIMYVEDGVFY GAKAKINVWKPDVEMPNEFSLAQIWVLGGNFNSDLNSIEAGWQHAIMYVEDGVFYGAKAKINVW KPDVEMPNEFSLAQIWVLGGNFNSDLNSIEAGWQHAIMYVEDGVFYGAKAKINVWKPDVEMPNE FSLAQIWVLGGNFNSDLNSIEAGWQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |