Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014812_circ_g.1 |
ID in PlantcircBase | zma_circ_008510 |
Alias | zma_circ_0002142 |
Organism | Zea mays |
Position | chr5: 63971008-63972128 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d014812 |
Parent gene annotation |
RNA-binding (RRM/RBD/RNP motifs) family protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d014812_T002:3 Zm00001d014812_T004:3 Zm00001d014812_T001:3 Zm00001d014812_T005:3 Zm00001d014812_T003:3 Zm00001d014812_T006:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.078038454 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
63972046-63971085(+) 63971029-63971886(-) |
Potential amino acid sequence |
MDTVEEAERCIKYLNGSVMEGRNITVEKVLKVPFIQQGAPKREVKITISSSVSV*(+) MKGTLSTFSTVMFRPSITEPLRYFMQRSASSTVSMLTKANPRETRVWGSRTTWQPTTLPCLEK* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |